PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G265400.1
Common NameB456_002G265400, LOC105786575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 329aa    MW: 37182.2 Da    PI: 8.588
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G265400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-3258111255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH rFv+ave+LGG+++AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Gorai.002G265400.1  58 PRLRWTPDLHLRFVHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYRS 111
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.92254114IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-3054112IPR009057Homeodomain-like
SuperFamilySSF466894.48E-1557112IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2358113IPR006447Myb domain, plants
PfamPF002491.2E-959110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MMEENSGTGC SKTVKAETES EENEGESRPK NGGSSSNSTV EENEKKPSVR PYVRSKLPRL  60
RWTPDLHLRF VHAVERLGGQ DRATPKLVLQ LMNIKGLSIA HVKSHLQMYR SKKIDDSGQV  120
ISDHRHLVES GDRNIYNLSQ LPMLQGYSNL HHHHHHHQGD SSSSFYRYGD ASWGNREYSM  180
SRPYTSTSFI NESRPGLHRT VTEKIFSSNW ASYDFKCNQV QPRLGPIETS SMSQNTSLSI  240
HNSNLISQDL KSTKRKTFDC DLDLDLSLRI TAKEDKQQNS EQDDVVSELS LSLYSPSSSS  300
SKLSRLKSEE DHCTKKNARR VSTLDLTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3949411e-135GQ394941.1 Gossypium hirsutum cultivar Delta Opal clone MONCS1964 SSR marker DPL0302 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468535.10.0PREDICTED: putative Myb family transcription factor At1g14600
RefseqXP_012468536.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A0D2QJL80.0A0A0D2QJL8_G
STRINGPOPTR_0016s12940.14e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-65G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]